Home Growth Factor & Endocrine Signaling Research Tesamorelin
Vial of Tesamorelin research compound with silver cap and Suria label, lit against a dark background with warm gold ambient light

Overview

A growth-hormone-releasing hormone analog.

Tesamorelin is a synthetic analog of growth hormone-releasing hormone (GHRH), extending the native 44-amino acid sequence with a stabilizing hexenoyl modification at the N-terminus. This structural change confers resistance to enzymatic degradation, making it a durable tool for studying growth hormone secretion and downstream metabolic pathways.

Suria's Tesamorelin is manufactured for high-purity peptide research, with analytical documentation to be made available through Suria's Batch Documentation system, supporting controlled research into GHRH-receptor activation and downstream GH/IGF-1 signaling.

Research Use Only. Not for human or veterinary use.

Specifications

Documented, down to the molecule.

Purity
See applicable batch documentation
Sequence
N-[(3E)-hex-3-enoyl]-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (44 amino acids; human GRF(1-44) sequence with an N-terminal hex-3-enoyl group)
Molecular Formula
C221H366N72O67S1
Molecular Weight
5,135.86 g/mol
CAS Number
218949-48-5
Storage
−20°C, lyophilized; protect from light and moisture
Appearance
White to off-white lyophilized powder
Research Category
Growth Factor & Endocrine Signaling Research

Certificate of Analysis

Product documentation.

Certificate of Analysis

Checking certificate…

Other documentation: Batch Documentation.

Research Highlights

Why researchers study it.

Growth Hormone Signaling

Studied for its stimulation of endogenous growth hormone secretion via the GHRH receptor.

GHRH-Receptor Signaling

Studied as a stabilized GHRH analogue that activates GHRH receptors and downstream GH/IGF-1 signaling.

Enzymatic Stability

Engineered with an N-terminal modification that resists rapid enzymatic breakdown.

Established Literature

One of the most extensively studied GHRH analogs in metabolic research.

Storage

Handled the way research deserves.

Lyophilized vials

Store as specified above, protected from light and moisture, until ready for reconstitution.

Reconstituted solution

Store at 2–8°C and use within the laboratory's established handling window.

Handling

Avoid repeated freeze-thaw cycles to help preserve peptide integrity across a research protocol.

Research Use Only. Not for human consumption.

Frequently Asked Questions

Good to know before you order.

How is it shipped?
Orders are packaged with care and shipped using protective, secure methods designed to help each vial arrive in excellent condition.
How should it be stored?
Store lyophilized vials as specified above, away from light and moisture. Once reconstituted, store at 2–8°C and use within the laboratory's established handling window.
Is this for human consumption?
No. Tesamorelin is sold strictly for laboratory and scientific research use. It is not intended for human or veterinary use, and is not a drug, dietary supplement, or food.
Why does purity matter?
Purity directly affects the reliability of research outcomes. Available analytical documentation, labelled with who issued it, can be reviewed for applicable batches through Suria's Batch Documentation system.

Batch Documentation

View available analytical documentation for this research product.

View Documentation